its_stephen_lee While in California, I have to follow the hype over IN N' OUT.. As requested @_jcsan @steelcurtin08 @mullymull11
2 double doubles
1 animal fry
1 strawberry milkshake
#CHEATHARDERTHANME #whileinrome#gainz #cheatmeal#impayingforit #california #cali #oxnard #ca #wolfpackonly
2w
  •   _jcsan Acosta said you owe him a bottle of jack for getting you that TDY.. Lol and I hate you. But I would be mad if you didn't do this cheat meal. 2w
  •   zamtrip girl I do this often 2w
  •   getripped45 Wow! 2w
  •   eli_thehiphopreneur We should network! 2w
  •   gcones20 Someone's hungry 2w
  •   highlevel_fighting Hey what's up! We are doing free martial arts seminars at the Hilton Garden Inn in Oxnard, I posted some videos in my feed so you can see what it's all about. Can you recommend anyone who you would think would be interested in something like this to us? 1w
  •   friendlyjenni Hi :) I Know this is random, but I don't Know anyone so I thought i'd give it a shot! I'm Kinda new to Oxnard, and Im in need of a house! By chance is there any one you can recommend who is looking to sell? 5d
  •   allshookupoxnard Hey whats up! Just wanted to give you a quick headz up, that thursday and Friday this week only we will be giving oxnard residents $6 shakes between the hours of 5:00 & pm Bring 4 friends & get your shake for free! - (All shook up nutrition) (Google us!) 4d

» LOG IN to write comment.

» LOG IN to write comment.

  •   _jcsan 3w
  •   scottiesummers Wow 3w
  •   _jcsan @scottiesummers lmao parham don't know bout that weight room.. Hopefully you been learning out there! 3w
  •   scottiesummers I've been in the weight room. Still can't gain weight that much but I'm stronger. So it went from skinny and tatted to skinny tatted and strong. @_jcsan 3w

» LOG IN to write comment.

its_stephen_lee in the end it comes down to what you want the most.. 3w

» LOG IN to write comment.

its_stephen_lee Gets me every time 😐😕 those ppl at work that make you want to lock YOUR lips because THEIR lips are so crusty. Don't mind me while I apply my Chapstick.. #rp #dontmindmewhileiapplymychapstick#crustylips#shameonyou#chappedlips#getsomechapstick# thestrongstuff 1mon

» LOG IN to write comment.

» LOG IN to write comment.

Normal Stephen (stef-en)

» LOG IN to write comment.

its_stephen_lee No matter the hair style
Got somebody,she is a beauty,
very special, really and truly..and strong enough to hold me #gotsomebody #nolettinggo#wcw#mywife#cornonthecob#number2pencil @dear_gailbriel
3mon

» LOG IN to write comment.

its_stephen_lee #repost..go look at a black chick's pg..or @zwhite216 you'll see this!!#Hilarious#truth#ebony#humor#lol#picstitch 3mon

» LOG IN to write comment.

Amaro Stephen (stef-en)
its_stephen_lee The military allows you to meet great people who become great friends. This is back in 2010 from our first free Veterans Day meals and we were all in the dorms. @yungspiff @zwhite216 @heavenlyinked #tbt #VeteransDay #dormlife 3mon

» LOG IN to write comment.

» LOG IN to write comment.

its_stephen_lee Post workout protein shake mustache selfie..with some flexing in the back. Bis, tris, and automobiles! With @steelcurtin08 #arms#bis#tris#abs#workout#nodaysoff#dontbesatisfied#protein#fit 4mon

» LOG IN to write comment.

  •   droblackrr I had one of them hoes the other day them things are fire 4mon
  •   keoni_jeremiah That next Friday shit right there. Yeah boi! 4mon
  •   _jcsan Jesus 4mon
  •   xtnsv Hahaha 3mon

» LOG IN to write comment.

Video Stephen (stef-en)

» LOG IN to write comment.

» LOG IN to write comment.

Video Stephen (stef-en)
its_stephen_lee I'm just a biker on his journey to find the pool #biker#onajourney#summertime#pool#pooltime#japan 4mon

» LOG IN to write comment.

» LOG IN to write comment.

its_stephen_lee Can't say it's my little sister's birthday because she's not so little anymore, but she'll ALWAYS be my baby sister no matter how big or old she'll be. Happy 11th birthday Poop head @abigail052103 @marie11222 #happybirthday#sister#11 4mon

» LOG IN to write comment.

Video Stephen (stef-en)
its_stephen_lee Who would think that a "country" girl would be afraid of a lizard..?!? @dear_gailbriel isn't allowed to watch any more scary movies. #countrygirl#scared#godzilla#monstar#lizard#japan#tokyo 4mon

» LOG IN to write comment.