brownfishy Gets me every time 😐😕 those ppl at work that make you want to lock YOUR lips because THEIR lips are so crusty. Don't mind me while I apply my Chapstick.. #rp #dontmindmewhileiapplymychapstick#crustylips#shameonyou#chappedlips#getsomechapstick# thestrongstuff 1w

» LOG IN to write comment.

» LOG IN to write comment.

2mon brownfishy
Normal Stephen (stef-en)

» LOG IN to write comment.

2mon brownfishy
Video Stephen (stef-en)
brownfishy No matter the hair style
Got somebody,she is a beauty,
very special, really and truly..and strong enough to hold me #gotsomebody #nolettinggo#wcw#mywife#cornonthecob#number2pencil @dear_gailbriel
2mon

» LOG IN to write comment.

2mon brownfishy
Mayfair Stephen (stef-en)
brownfishy #repost..go look at a black chick's pg..or @zwhite216 you'll see this!!#Hilarious#truth#ebony#humor#lol#picstitch 2mon

» LOG IN to write comment.

2mon brownfishy
Amaro Stephen (stef-en)
brownfishy The military allows you to meet great people who become great friends. This is back in 2010 from our first free Veterans Day meals and we were all in the dorms. @yungspiff @zwhite216 @heavenlyinked #tbt #VeteransDay #dormlife 2mon

» LOG IN to write comment.

2mon brownfishy
Video Stephen (stef-en)

» LOG IN to write comment.

brownfishy Post workout protein shake mustache selfie..with some flexing in the back. Bis, tris, and automobiles! With @steelcurtin08 #arms#bis#tris#abs#workout#nodaysoff#dontbesatisfied#protein#fit 3mon

» LOG IN to write comment.

  •   droblackrr I had one of them hoes the other day them things are fire 3mon
  •   keoni_jeremiah That next Friday shit right there. Yeah boi! 3mon
  •   _jcsan Jesus 3mon
  •   xtnsv Hahaha 2mon

» LOG IN to write comment.

brownfishy Random thought on my mind I guess.lol #randomthoughts#noshame #everybodydoesit #dontlie #imnotmadatyou 3mon

» LOG IN to write comment.

3mon brownfishy
Hudson Stephen (stef-en)

» LOG IN to write comment.

3mon brownfishy
Video Stephen (stef-en)
brownfishy I'm just a biker on his journey to find the pool #biker#onajourney#summertime#pool#pooltime#japan 3mon

» LOG IN to write comment.

3mon brownfishy
Normal Stephen (stef-en)

» LOG IN to write comment.

brownfishy Can't say it's my little sister's birthday because she's not so little anymore, but she'll ALWAYS be my baby sister no matter how big or old she'll be. Happy 11th birthday Poop head @abigail052103 @marie11222 #happybirthday#sister#11 3mon

» LOG IN to write comment.

3mon brownfishy
Video Stephen (stef-en)
brownfishy Who would think that a "country" girl would be afraid of a lizard..?!? @dear_gailbriel isn't allowed to watch any more scary movies. #countrygirl#scared#godzilla#monstar#lizard#japan#tokyo 3mon

» LOG IN to write comment.

brownfishy The people/things you'll see on the train..This chick looks like she's out of an anime comic. #Anime #japan #Japanese#Tokyo#ispy#japanlife 4mon

» LOG IN to write comment.

4mon brownfishy
Normal Stephen (stef-en)
brownfishy Seeing eye to eye. Am I missing teeth 😦 they say we look alike.. #marriedlife#beweird #havefun#funcouple#odd @dear_gailbriel 4mon

» LOG IN to write comment.

4mon brownfishy
Video Stephen (stef-en)
brownfishy Happy Friday morning, make today yours! Seize the day #carpediem##happyhumblehungry #friday#happyfriday#beblessed #carpe_diem #dontbesatisfied 4mon

» LOG IN to write comment.

4mon brownfishy
Rise Stephen (stef-en)
brownfishy That extra energy you get when you get out of work early and it's nice out... #cruisin#drivin#gymetime#floral#5panal#cutoff#theresthatguy#hideyourkids#wolfpack#yokota#japan 4mon

» LOG IN to write comment.

4mon brownfishy
Video Stephen (stef-en)
brownfishy Well, excuse me. Got that good drank manne!! 99cents for a 12 pack, I gots mines! #drank#goodgood#bargain#juice#doinme#dontbesatisfied#stephen#royer#inclass#boredom#tillthelastdrop 4mon

» LOG IN to write comment.